PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00104388001
Common NameGSBRNA2T00104388001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 208aa    MW: 23720.8 Da    PI: 8.6482
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00104388001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.46e-321568255
              G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         prlrW+++LH++Fv+aveqLGG+++AtPk +l+lm+v gLt++hvkSHLQ+YR+
  GSBRNA2T00104388001 15 PRLRWNSDLHNSFVQAVEQLGGEHRATPKMVLQLMDVRGLTISHVKSHLQMYRS 68
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.0681171IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.1E-301169IPR009057Homeodomain-like
SuperFamilySSF466895.38E-141368IPR009057Homeodomain-like
TIGRFAMsTIGR015576.8E-241569IPR006447Myb domain, plants
PfamPF002492.7E-61667IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MKTPIVRSYV RSKVPRLRWN SDLHNSFVQA VEQLGGEHRA TPKMVLQLMD VRGLTISHVK  60
SHLQMYRSMK LEESMQDEIL AKRSVRVTGE VTWWQFQQYL HNYQRLRGNA NLFQNQLRRE  120
DEMYENIITF GESSNGIKDV PSDYFTCTSL YESSRVRVSK SKADDDNGKI VCDIGDDGNV  180
VTVSVKSTKA SKGEEESSLE LTLGLKP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00104388001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0740214e-35AF074021.1 Arabidopsis thaliana BAC F4H6, chromosome IV, complete sequence.
GenBankAL1615014e-35AL161501.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 13.
GenBankCP0026874e-35CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009144511.11e-154PREDICTED: uncharacterized protein LOC103868161
TrEMBLA0A078E9A21e-154A0A078E9A2_BRANA; BnaA02g21100D protein
STRINGscaffold_603773.13e-45(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04580.18e-35G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]